Proteintech, 30025-1-AP, CNDP2 Polyclonal antibody

Size: 20ul / 150ul The CNDP2 (30025-1-AP) by Proteintech is a Polyclonal antibody targeting CNDP2 in WB, ELISA applications with reactivity to Human samples 30025-1-AP targets CNDP2 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HEK-293T cells, HL-60 cells, Jurkat cells, PC-3 cells, U-251 cells, U-937 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information Carnosine dipeptidase II (CNDP2) catalyzes the peptide bond hydrolysis in dipeptides, displaying a non-redundant activity toward threonyl dipeptides. It has high dipeptidase activity toward cysteinyl glycine, an intermediate metabolite in glutathione metabolism (PubMed:19346245, PubMed:12473676). Metabolizes N-lactoyl-amino acids, both through hydrolysis to form lactic acid and amino acids, as well as through their formation by reverse proteolysis (PubMed:25964343). CNDP2 has 2 isoforms with a molecular weight of 53 and 44 kDa. The isoform 1 is ubiquitously expressed with higher levels in the kidney and liver (at protein level) and expressed in peripheral blood leukocytes (PubMed:12473676). It is also expressed in gastric mucosa and down-regulated in gastric cancer mucosal tissues (at the protein level) (PubMed:24395568). Isoform 2 is broadly expressed in fetal tissues and expressed in the adult liver and placenta. (PMID: 17121880). Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32312 Product name: Recombinant human CNDP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 150-305 aa of BC001375 Sequence: TGQEIPVNVRFCLEGMEESGSEGLDELIFARKDTFFKDVDYVCISDNYWLGKKKPCITYGLRGICYFFIEVECSNKDLHSGVYGGSVHEAMTDLILLMGSLVDKRGNILIPGINEAVAAVTEEEHKLYDDIDFDIEEFAKDVGAQILLHSHKKDIL Predict reactive species Full Name: CNDP dipeptidase 2 (metallopeptidase M20 family) Calculated Molecular Weight: 53 kDa Observed Molecular Weight: 44-53 kDa GenBank Accession Number: BC001375 Gene Symbol: CNDP2 Gene ID (NCBI): 55748 RRID: AB_2935503 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96KP4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.