Proteintech, 30133-1-AP, PLCD4 Polyclonal antibody

Size: 20ul / 150ul The PLCD4 (30133-1-AP) by Proteintech is a Polyclonal antibody targeting PLCD4 in WB, IHC, ELISA applications with reactivity to Human, rat, mouse samples 30133-1-AP targets PLCD4 in WB, IHC, RIP, ELISA applications and shows reactivity with Human, rat, mouse samples. Tested Applications Positive WB detected in: HeLa cells, rat testis tissue, human testis tissue Positive IHC detected in: mouse testis tissue, human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information PLCD4(1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4), also known as hPLCD4. It is highly expressed in skeletal muscle and kidney tissues. It may be an important enzyme for intracellular Ca²⁺ mobilization in the zona pellucida-induced acrosome reaction. PLCD4 cooperates with nuclear PKC to regulate liver regeneration. Overexpression of PLCD4 upregulates Erk signaling pathway and proliferation (PMID: 15140260). Specification Tested Reactivity: Human, rat, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32651 Product name: Recombinant human PLCD4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-290 aa of BC006355 Sequence: MASLLQDQLTTDQDLLLMQEGMPMRKVRSKSWKKLRYFRLQNDGMTVWHARQARGSAKPSFSISDVETIRNGHDSELLRSLAEELPLEQGFTIVFHGRRSNLDLMANSVEEAQIWMRGLQLLVDLVTSMDHQERLDQWLSDWFQRGDKNQDGKMSFQEVQRLLHLMNVEMDQEYAFSLFQAADTSQSGTLEGEEFVQFYKALTKRAEVQELFESFSADGQKLTLLEFLDFLQEEQKERDCTSELALELIDRYEPSDSGKLRHVLSMDGFLSYLCSKDGDIFNPACLPIYQ Predict reactive species Full Name: phospholipase C, delta 4 Calculated Molecular Weight: 85-90 kDa Observed Molecular Weight: 90 kDa GenBank Accession Number: BC006355 Gene Symbol: PLCD4 Gene ID (NCBI): 84812 RRID: AB_2935518 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BRC7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.