Iright
BRAND / VENDOR: Proteintech

Proteintech, 30173-1-AP, DDB2 Polyclonal antibody

CATALOG NUMBER: 30173-1-AP
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DDB2 (30173-1-AP) by Proteintech is a Polyclonal antibody targeting DDB2 in WB, ELISA applications with reactivity to Human, Mouse, Rat samples 30173-1-AP targets DDB2 in WB, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: A431 cells, PC-12 cells, HCT 116 cells, HeLa cells, HepG2 cells, Jurkat cells, NIH/3T3 cells, mouse kidney tissue, mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Background Information DDB2, also named as DNA damage-binding protein 2 or UV-damaged DNA-binding protein 2, is a 427 amino acid protein, which contains seven WD repeats and belongs to the WD repeat DDB2/WDR76 family. DDB2 is ubiquitously expressed, with highest levels in corneal endothelium and lowest levels in brain. DDB2 localizes in the nucleus and is required for DNA repair. DDB2 regulates negatively the constitutive expression of the SOD2 gene in breast cancer cells and exerts, at least in part, a control of breast cancer cell growth. DDB2 can play a role as oncogene and may become a promising candidate as a predictive marker in breast cancer. Specification Tested Reactivity: Human, Mouse, Rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32811 Product name: Recombinant human DDB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 46-320 aa of NM_000107 Sequence: RRCDSDCLWVGLAGPQILPPCRSIVRTLHQHKLGRASWPSVQQGLQQSFLHTLDSYRILQKAAPFDRRATSLAWHPTHPSTVAVGSKGGDIMLWNFGIKDKPTFIKGIGAGGSITGLKFNPLNTNQFYASSMEGTTRLQDFKGNILRVFASSDTINIWFCSLDVSASSRMVVTGDNVGNVILLNMDGKELWNLRMHKKKVTHVALNPCCDWFLATASVDQTVKIWDLRQVRGKASFLYSLPHRHPVNAACFSPDGARLLTTDQKSEIRVYSASQW Predict reactive species Full Name: damage-specific DNA binding protein 2, 48kDa Calculated Molecular Weight: 48 kDa Observed Molecular Weight: 48-51 kDa GenBank Accession Number: NM_000107 Gene Symbol: DDB2 Gene ID (NCBI): 1643 RRID: AB_2935524 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92466 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924