Proteintech, 30188-1-AP, TASOR Polyclonal antibody

Size: 20ul / 150ul The TASOR (30188-1-AP) by Proteintech is a Polyclonal antibody targeting TASOR in WB, IHC, ELISA applications with reactivity to human, mouse samples 30188-1-AP targets TASOR in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, Jurkat cells Positive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information TASOR, also known as FAM208A or C3orf63, is the central subunit of the human silencing hub (HUSH) complex. HUSH regulates deposition of the epigenetic mark H3K9me3. TASOR has a catalytically-inactive PARP domain which is necessary for targeted H3K9me3 deposition (PMID: 33009411). TASOR and the RNA deadenylase CCR4-NOT complex scaffold CNOT1 synergistically repress HIV proviral expression (PMID: 35013187). TASOR affects the genome stability during the cellular division and also interacts with methylation complex in adult tissues (PMID: 34272044). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32757 Product name: Recombinant human TASOR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1361-1512 aa of NM_001112736.1 Sequence: GKWQWKVHCKFQKKLKELGRLNAKALSLLTLLNVYQKKHLVEILSYHNCDSQTRNAPELDCLIRLQAQNIQQRHIVFLTEKNIKMLSSYTDNGIVVATAEDFMQNFKNLVGYHNSITEENLPQLGANENLESQSALLENDEKDEEDMSLDSG Predict reactive species Full Name: chromosome 3 open reading frame 63 Calculated Molecular Weight: 189 kDa Observed Molecular Weight: 189 kDa GenBank Accession Number: NM_001112736.1 Gene Symbol: TASOR Gene ID (NCBI): 23272 RRID: AB_2935527 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UK61 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.