Proteintech, 30191-1-AP, PDZD2 Polyclonal antibody

Size: 20ul / 150ul The PDZD2 (30191-1-AP) by Proteintech is a Polyclonal antibody targeting PDZD2 in WB, IHC, ELISA applications with reactivity to Human, mouse samples 30191-1-AP targets PDZD2 in WB, IHC, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, Jurkat cells Positive IHC detected in: mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information PDZD2, PDZ-domain containing-2, also named as AIPC, KIAA0300 and PDZK3, is associated with the early promotion of prostate tumoregenesis. The antibody recognizes near the N-term of PDZD2. PDZD2 is a novel factor that affects the growth and differentiation of human fetal pancreatic progenitor cells. The secreted form sPDZD2 can be detected 37 kDa (PMID: 18037333). Specification Tested Reactivity: Human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32900 Product name: Recombinant human PDZD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2519-2641 aa of NM_178140 Sequence: RRSPGPPAGGVSCPEKGGNRACPGGSGPKTSAAETPSSASDTGEAAQDLPFRRSWSVNLDQLLVSAGDQQRLQSVLSSVGSKSTILTLIQEAKAQSENEEDVCFIVLNRKEGSGLGFSVAGGT Predict reactive species Full Name: PDZ domain containing 2 Calculated Molecular Weight: 302 kDa Observed Molecular Weight: 37 kDa GenBank Accession Number: NM_178140 Gene Symbol: PDZD2 Gene ID (NCBI): 23037 RRID: AB_3086258 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O15018 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.