Product Description
Size: 20ul / 150ul
The Antizyme inhibitor 1 (30383-1-AP) by Proteintech is a Polyclonal antibody targeting Antizyme inhibitor 1 in WB, ELISA applications with reactivity to human samples
30383-1-AP targets Antizyme inhibitor 1 in WB, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: A549 cells, HepG2 cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Background Information
AZIN1(Antizyme inhibitor 1) is also named as OAZI, OAZIN and belongs to the Orn/Lys/Arg decarboxylase class-II family. It catalyzes the conversion of ornithine to putrescine in the first and apparently rate-limiting step in polyamine biosynthesis, and playing a role in the regulation of polyamine synthesis (negative regulator of cellular polyamines).
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag33058 Product name: Recombinant human AZIN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 124-213 aa of BC019279 Sequence: AKVGVNILTCDNEIELKKIARNHPNAKVLLHIATEDNIGGEEGNMKFGTTLKNCRHLLECAKELDVQIIGVKFHVSSACKESQVYVHALS Predict reactive species
Full Name: antizyme inhibitor 1
Calculated Molecular Weight: 49.5 kDa
Observed Molecular Weight: 40-50 kDa
GenBank Accession Number: BC019279
Gene Symbol: AZIN1
Gene ID (NCBI): 51582
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: O14977
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924