Proteintech, 30383-1-AP, Antizyme inhibitor 1 Polyclonal antibody

Size: 20ul / 150ul The Antizyme inhibitor 1 (30383-1-AP) by Proteintech is a Polyclonal antibody targeting Antizyme inhibitor 1 in WB, ELISA applications with reactivity to human samples 30383-1-AP targets Antizyme inhibitor 1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information AZIN1(Antizyme inhibitor 1) is also named as OAZI, OAZIN and belongs to the Orn/Lys/Arg decarboxylase class-II family. It catalyzes the conversion of ornithine to putrescine in the first and apparently rate-limiting step in polyamine biosynthesis, and playing a role in the regulation of polyamine synthesis (negative regulator of cellular polyamines). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33058 Product name: Recombinant human AZIN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 124-213 aa of BC019279 Sequence: AKVGVNILTCDNEIELKKIARNHPNAKVLLHIATEDNIGGEEGNMKFGTTLKNCRHLLECAKELDVQIIGVKFHVSSACKESQVYVHALS Predict reactive species Full Name: antizyme inhibitor 1 Calculated Molecular Weight: 49.5 kDa Observed Molecular Weight: 40-50 kDa GenBank Accession Number: BC019279 Gene Symbol: AZIN1 Gene ID (NCBI): 51582 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14977 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.