Proteintech, 30415-1-AP, G-CSF Polyclonal antibody

Size: 20ul / 150ul The G-CSF (30415-1-AP) by Proteintech is a Polyclonal antibody targeting G-CSF in WB, ELISA applications with reactivity to human, mouse samples 30415-1-AP targets G-CSF in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, K-562 cells, L02 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Granulocyte colony-stimulating factor (G-CSF), also referred to as CSF3, is a protective cytokine with anti-inflammatory effects. G-CSF is important in promoting survival of the granulocytic lineage cells and proliferation and migration of neutrophils as well as trophoblast cells. G-CSF acts by binding to its receptor G-CSFR (also called CSF3R), which after binding with G-CSF activates the canonical Janus kinase (Jak)/signal transducer, activator of transcription (STAT)and Ras/Raf/MAP kinase pathways. G-CSF potently stimulates the proliferation and release of peripheral blood progenitor cells into the bloodstream and is therefore used to treat neutropenia after chemotherapy. Furthermore, G-CSF levels are elevated upon intensive exercise leading to increased neutrophil counts, which are predominantly due to delayed neutrophil apoptosis. Specification Tested Reactivity: human, mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg0256 Product name: Recombinant Mouse G-CSF protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 31-208 aa of NM_009971 Sequence: VPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA Predict reactive species Full Name: colony stimulating factor 3 (granulocyte) Calculated Molecular Weight: 22kd Observed Molecular Weight: 18-20 kDa GenBank Accession Number: NM_009971 Gene Symbol: Csf3 Gene ID (NCBI): 12985 RRID: AB_3669720 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P09920 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.