Proteintech, 30419-1-AP, CHI3L1/YKL40 Polyclonal antibody

Size: 20ul / 150ul The CHI3L1/YKL40 (30419-1-AP) by Proteintech is a Polyclonal antibody targeting CHI3L1/YKL40 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 30419-1-AP targets CHI3L1/YKL40 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HT-29 cells, HepG2 cells Positive IF/ICC detected in: THP-1 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Chitinase 3-like-1 (CHI3L1/YKL-40/CGP-39/GP-39/hCGP-39) is a protein secreted from restricted cell types including colonic epithelial cells (CECs) and macrophages. CHI3L1 is an inflammation-associated molecule, and its expression is enhanced in persons with colitis and colon cancer. CHI3L1 is a 40 kDa protein and is produced by restricted cell types, including colonic epithelial cells (CECs) and macrophages. CHI3L1 can be detected in the Golgi apparatus and the endoplasmic reticulum, but its major sites of action seems to be extracellular as a secreted protein. (PMID:21763261) Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33123 Product name: Recombinant human CHI3L1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 223-383 aa of BC008568 Sequence: FRGQEDASPDRFSNTDYAVGYMLRLGAPASKLVMGIPTFGRSFTLASSETGVGAPISGPGIPGRFTKEAGTLAYYEICDFLRGATVHRILGQQVPYATKGNQWVGYDDQESVKSKVQYLKDRQLAGAMVWALDLDDFQGSFCGQDLRFPLTNAIKDALAAT Predict reactive species Full Name: chitinase 3-like 1 (cartilage glycoprotein-39) Calculated Molecular Weight: 383 aa, 43 kDa Observed Molecular Weight: 40-43 kDa GenBank Accession Number: BC008568 Gene Symbol: CHI3L1 Gene ID (NCBI): 1116 RRID: AB_3086309 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P36222 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.