Proteintech, 30426-1-AP, TPST2 Polyclonal antibody

Size: 20ul / 150ul The TPST2 (30426-1-AP) by Proteintech is a Polyclonal antibody targeting TPST2 in WB, ELISA applications with reactivity to human, mouse samples 30426-1-AP targets TPST2 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information TPST2 catalyzes the O-sulfation of tyrosine residues within acidic motifs of polypeptides, using 3'-phosphoadenylyl sulfate (PAPS) as cosubstrate (PMID: 9733778). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32362 Product name: Recombinant human TPST2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 295-377 aa of BC017509 Sequence: LEALSKWTGHIPGDVVRDMAQIAPMLAQLGYDPYANPPNYGNPDPFVINNTQRVLKGDYKTPANLKGYFQVNQNSTSSHLGSS Predict reactive species Full Name: tyrosylprotein sulfotransferase 2 Calculated Molecular Weight: 377 aa, 42 kDa Observed Molecular Weight: 42 kDa GenBank Accession Number: BC017509 Gene Symbol: TPST2 Gene ID (NCBI): 8459 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O60704 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.