Proteintech, 30458-1-AP, FBXO7 Polyclonal antibody

Size: 20ul / 150ul The FBXO7 (30458-1-AP) by Proteintech is a Polyclonal antibody targeting FBXO7 in WB, ELISA applications with reactivity to Human samples 30458-1-AP targets FBXO7 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: MCF-7 cells, Raji cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information FBXO7, also named as FBX7, is a substrate recognition component of a (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. FBXO7 recognizes BIRC2 and DLGAP5. It function in phosphorylation-dependent ubiquitination. Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32796 Product name: Recombinant human FBXO7 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 378-522 aa of BC008361 Sequence: RDFRDNTVRVQDTDWKELYRKRHIQRKESPKGRFVMLLPSSTHTIPFYPNPLHPRPFPSSRLPPGIIGGEYDQRPTLPYVGDPISSLIPGPGETPSQFPPLRPRFDPVGPLPGPNPILPGRGGPNDRFPFRPSRGRPTDGRLSFM Predict reactive species Full Name: F-box protein 7 Calculated Molecular Weight: 59 kDa Observed Molecular Weight: 59-75 kDa GenBank Accession Number: BC008361 Gene Symbol: FBXO7 Gene ID (NCBI): 25793 RRID: AB_3086324 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y3I1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.