Proteintech, 30602-1-AP, GHSR Polyclonal antibody

Size: 20ul / 150ul The GHSR (30602-1-AP) by Proteintech is a Polyclonal antibody targeting GHSR in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 30602-1-AP targets GHSR in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: TT cells Positive IHC detected in: rat brain tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information The Growth Hormone Secretagogue Receptor (GHSR), also known as the ghrelin receptor, is a G protein-coupled receptor (GPCR) that plays a crucial role in regulating energy homeostasis, body weight, and growth hormone (GH) release. The GHSR is highly expressed in the brain, and also in some peripheral tissues. GHSR activity is evoked by the stomach-derived peptide hormone ghrelin and abrogated by the intestine-derived liver antimicrobial peptide 2 (LEAP2). (PMID: 33157147) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30358 Product name: Recombinant human GHSR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-72 aa of NM_198407 Sequence: MWNATPSEEPGFNLTLADLDWDASPGNDSLGDELLQLFPAPLLAGVTATCVALFVVGIAGNLLTMLVVSRFR Predict reactive species Full Name: growth hormone secretagogue receptor Calculated Molecular Weight: 41 kDa Observed Molecular Weight: 41 kDa GenBank Accession Number: NM_198407 Gene Symbol: GHSR Gene ID (NCBI): 2693 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92847 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.