Proteintech, 30618-1-AP, MLPH Polyclonal antibody

Size: 20ul / 150ul The MLPH (30618-1-AP) by Proteintech is a Polyclonal antibody targeting MLPH in WB, IHC, ELISA applications with reactivity to human samples 30618-1-AP targets MLPH in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HT-29 cells, LNCaP cells, MCF-7 cells, PC-3 cells Positive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Melanophilin (Mlph) is a member of the exophilin subfamily of Rab effector proteins. MLPH is a modular protein, forming a ternary complex with the small Ras-related GTPase Rab27A in its GTP-bound form and the motor protein myosin Va. It regulates retention of melanosomes at the peripheral actin cytoskeleton of melanocytes, a process essential for normal mammalian pigmentation. Defects in MLPH are a cause of Griscelli syndrome type 3 (GS3), which is characterized by a silver-gray hair color and abnormal pigment distribution in the hair shaft. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32931 Product name: Recombinant human MLPH protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 372-600 aa of BC001653 Sequence: AGVRTEADVEEEALRRKLEELTSNVSDQETSSEEEEAKDEKAEPNRDKSVGPLPQADPEVGTAAHQTNRQEKSPQDPGDPVQYNRTTDEELSELEDRVAVTASEVQQAESEVSDIESRIAALRAAGLTVKPSGKPRRKSNLPIFLPRVAGKLGKRPEDPNADPSSEAKAMAVPYLLRRKFSNSLKSQGKDDDSFDRKSVYRGSLTQRNPNARKGMASHTFAKPVVAHQS Predict reactive species Full Name: melanophilin Calculated Molecular Weight: 66 kDa Observed Molecular Weight: 66 kDa, 80 kDa GenBank Accession Number: BC001653 Gene Symbol: MLPH Gene ID (NCBI): 79083 RRID: AB_3669739 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BV36 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.