Proteintech, 30714-1-AP, Integrin alpha-8 Polyclonal antibody

Size: 20ul / 150ul The Integrin alpha-8 (30714-1-AP) by Proteintech is a Polyclonal antibody targeting Integrin alpha-8 in WB, IHC, IF-P, ELISA applications with reactivity to Human, Mouse, Rat samples 30714-1-AP targets Integrin alpha-8 in WB, IHC, IF-P, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: mouse lung tissue, rat lung tissue, rat spleen tissue Positive IHC detected in: mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse lung tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information Integrins are cell adhesion receptors that are heterodimers composed of non-covalently associated α and β subunits. Integrin alpha-8 is a single-pass type I membrane protein that forms a heterodimer with integrin beta-1 to serve as a receptor for RGD-containing matrix molecules (fibronectin, vitronectin, tenascin C, osteopontin, and nephronectin) (PMID: 33000355). Integrin alpha-8 beta-1 plays a critical role in epithelial-mesenchymal interactions and functions in the genesis of kidney and probably of other organs (PMID: 9054500; 19769957). The apparent molecular weight of integrin alpha-8 is larger than the calculated molecular weight of 117 kDa, possibly due to glycosylation (PMID: 7768999). Specification Tested Reactivity: Human, Mouse, Rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33507 Product name: Recombinant human Integrin alpha-8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 791-970 aa of NM_003638 Sequence: GVSHPPQIVLPIHNWEPEEEPHKEEEVGPLVEHIYELHNIGPSTISDTILEVGWPFSARDEFLLYIFHIQTLGPLQCQPNPNINPQDIKPAASPEDTPELSAFLRNSTIPHLVRKRDVHVVEFHRQSPAKILNCTNIECLQISCAVGRLEGGESAVLKVRSRLWAHTFLQRKNDPYALAS Predict reactive species Full Name: integrin, alpha 8 Calculated Molecular Weight: 117 kDa Observed Molecular Weight: 140 kDa GenBank Accession Number: NM_003638 Gene Symbol: Integrin alpha 8 Gene ID (NCBI): 8516 RRID: AB_3086397 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P53708 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.