Proteintech, 30845-1-AP, FAM136A Polyclonal antibody

Size: 20ul / 150ul The FAM136A (30845-1-AP) by Proteintech is a Polyclonal antibody targeting FAM136A in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 30845-1-AP targets FAM136A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells, MCF-7 cells, U2OS cells, Calu-1 cells, mouse testis tissue, rat testis tissue, HeLa cells, Jurkat cells Positive IHC detected in: human ovary cancer tissue, mouse testis tissue, rat testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information FAM136A is an evolutively conserved nuclear gene encoding a mitochondrial protein whose specific function is unknown, but which is commonly found in neurosensory epithelial cells, where it plays a role in the electron transport chain of respiration (PMID: 37461313). FAM136A, with a molecular mass of 16-kDa, is normally expressed in the cytoplasm and has been linked to familial Meniere's disease. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34058 Product name: Recombinant human FAM136A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-138 aa of BC014975 Sequence: MAELQQLRVQEAVESMVKSLERENIRKMQGLMFRCSASCCEDSQASMKQVHQCIERCHVPLAQAQALVTSELEKFQDRLARCTMHCNDKAKDSIDAGSKELQVKQQLDSCVTKCVDDHMHLIPTMTKKMKEALLSIGK Predict reactive species Full Name: family with sequence similarity 136, member A Observed Molecular Weight: 15 kDa GenBank Accession Number: BC014975 Gene Symbol: FAM136A Gene ID (NCBI): 84908 RRID: AB_3086420 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q96C01 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.