Proteintech, 30999-1-AP, Glypican-5 Polyclonal antibody

Size: 20ul / 150ul The Glypican-5 (30999-1-AP) by Proteintech is a Polyclonal antibody targeting Glypican-5 in WB, ELISA applications with reactivity to human samples 30999-1-AP targets Glypican-5 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, NCI-H1299 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information Glypican-5 (GPC5), which is predicted to be located in the cell membrane. In adult, primarily expressed in the brain. Also detected in fetal brain, lung and liver (PMID: 9070915). Glypican-5 is a member of heparan sulfate proteoglycans. The repressive role of GPC5 intumorigenesis has been reported in a variety of cancers, including rhabdomyosarcoma, breast cancer, and prostate cancer. GPC5, which is lowly expressed in lung cancer tissues compared with adjacent noncancerous tissues, exhibits a suppressive effect on migration and invasion, and it can also induce G1/S phase arrest of the lung cancer cells in vitro, which is associated with a better prognosis (PMID: 34079082). The molecular weight of Glypican-5 is 63 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34039 Product name: Recombinant human GPC5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-225 aa of BC039730 Sequence: EGVQTCEEVRKLFQWRLLGAVRGLPDSPRAGPDLQVCISKKPTCCTRKMEERYQIAARQDMQQFLQTSSSTLKFLISRNAAAFQETLETLIKQAENYTSILFCSTYRNMALEAAASVQEFFTDVGLYLFGADVNPEEFVNRFFDSLFPLVYNHLINPGVTDSSLEYSECIRMARRDVSPFGNIPQRVMGQMGRSLLPSRTF Predict reactive species Full Name: glypican 5 Calculated Molecular Weight: 572 aa, 64 kDa Observed Molecular Weight: 63 kDa GenBank Accession Number: BC039730 Gene Symbol: Glypican 5 Gene ID (NCBI): 2262 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P78333 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.