Proteintech, 31090-1-AP, Atox1 Polyclonal antibody

Size: 20ul / 150ul The Atox1 (31090-1-AP) by Proteintech is a Polyclonal antibody targeting Atox1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 31090-1-AP targets Atox1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: NCI-H1299 cells Positive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:150-1:600 Background Information Antioxidant 1 copper chaperone (Atox1) is a small cytosolic protein containing an MBS (metal binding site) and a potential NLS (nuclear localisation signal). It plays an essential role in copper homeostasis by facilitating the transfer of copper to the trans-Golgi. Atox1 has been implicated in a wide range of diseases, including many neurodegenerative, cancer and metabolic disorders. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35290 Product name: Recombinant mouse Atox1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-68 aa of NM_009720 Sequence: MPKHEFSVDMTCEGCAEAVSRVLNKLGGVEFNIDLPNKKVCIDSEHSSDTLLATLNKTGKAVSYLGPK Predict reactive species Full Name: ATX1 (antioxidant protein 1) homolog 1 (yeast) Calculated Molecular Weight: 7 kDa Observed Molecular Weight: 7-10 kDa GenBank Accession Number: NM_009720 Gene Symbol: Atox1 Gene ID (NCBI): 11927 RRID: AB_3669848 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: O08997 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.