Proteintech, 31094-1-AP, IKZF4 Polyclonal antibody

Size: 20ul / 150ul The IKZF4 (31094-1-AP) by Proteintech is a Polyclonal antibody targeting IKZF4 in WB, ELISA applications with reactivity to human samples 31094-1-AP targets IKZF4 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells, Raji cells, THP-1 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information IKZF4 is a member of the Ikaros family transcription factors. The Ikaros family was originally designated to function in hematopoiesis, but it is only recently that studies have begun to show the relevance of this family in T helper cell differentiation. IKZF3 was preferentially expressed in TH17 cells and governs TH17 differentiation by silencing IL-2 expression. By investigating the dynamics of the TH17 regulatory network, IKZF4 was proposed by Yosef et al. as a composite in the negative regulatory module for TH17. (PMID: 24644282) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34767 Product name: Recombinant human IKZF4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 268-457 aa of BC160169 Sequence: ERCHNYLQSLSTEAQALAGQPGDEIRDLEMVPDSMLHSSSERPTFIDRLANSLTKRKRSTPQKFVGEKQMRFSLSDLPYDVNSGGYEKDVELVAHHSLEPGFGSSLAFVGAEHLRPLRLPPTNCISELTPVISSVYTQMQPLPGRLELPGSREAGEGPEDLADGGPLLYRPRGPLTDPGASPSNGCQDST Predict reactive species Full Name: IKAROS family zinc finger 4 (Eos) Observed Molecular Weight: 64-70 kDa GenBank Accession Number: BC160169 Gene Symbol: IKZF4 Gene ID (NCBI): 64375 RRID: AB_3669852 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H2S9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.