Proteintech, 31173-1-AP, METTL8 Polyclonal antibody

Size: 20ul / 150ul The METTL8 (31173-1-AP) by Proteintech is a Polyclonal antibody targeting METTL8 in WB, IF/ICC, ELISA applications with reactivity to human samples 31173-1-AP targets METTL8 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: COLO 205 cells, HCT 116 cells, LoVo cells, SW480 cells Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information METTL8 (methyltransferase-like protein 8) is an m3C methyltransferase that is best known for its mitochondrial role in installing m3C32 on mt-tRNAThr/Ser(UCN). METTL8 has proved to be a transcriptional target of STAT3 that mediates STAT3's functions in mESCs (PMID: 29706498). METTL8 has multiple splicing isoforms and can undergo sumoylation and associate with nuclear RNA-binding proteins to regulate R-loop formation on ribosomal DNA gene (presumably via its methyltransferase activity on m3C) (PMID: 38744809). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34222 Product name: Recombinant human METTL8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-77 aa of BC025250 Sequence: MNMIWRNSISCLRLGKVPHRYQSGYHPVAPLGSRILTDPAKVFEHNMWDHMQWSKEEEAAARKKVKENSAVRVLLEE Predict reactive species Full Name: methyltransferase like 8 Calculated Molecular Weight: 33 kDa Observed Molecular Weight: 33~40 kDa GenBank Accession Number: BC025250 Gene Symbol: METTL8 Gene ID (NCBI): 79828 RRID: AB_3669881 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9H825 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.