Proteintech, 31174-1-AP, DLST Polyclonal antibody

Size: 20ul / 150ul The DLST (31174-1-AP) by Proteintech is a Polyclonal antibody targeting DLST in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 31174-1-AP targets DLST in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, MCF-7 cells Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:300-1:1200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information DLST (Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex) ) is the E2 transferase of α-ketoglutarate dehydrogenase complex (KGDHC) that regulates the irreversible conversion of α-ketoglutarate to succinyl-CoA in the TCA cycle.RNAi knockdown of DLST led to decreased cell viability and induction of apoptosis in human T-ALL cell lines. High DLST expression predicts poor overall and recurrencefree survival among TNBC patients (PMID: 26876595, 34785772). DLST has two isoforms of 40 kDa, 49 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34753 Product name: Recombinant human DLST protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 212-366 aa of BC001922 Sequence: EPGAGKGLRSEHREKMNRMRQRIAQRLKEAQNTCAMLTTFNEIDMSNIQEMRARHKEAFLKKHNLKLGFMSAFVKASAFALQEQPVVNAVIDDTTKEVVYRDYIDISVAVATPRGLVVPVIRNVEAMNFADIERTITELGEKARKNELAIEDMDG Predict reactive species Full Name: dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex) Calculated Molecular Weight: 49 kDa Observed Molecular Weight: 40 kDa, 49 kDa GenBank Accession Number: BC001922 Gene Symbol: DLST Gene ID (NCBI): 1743 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P36957 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.