Iright
BRAND / VENDOR: Proteintech

Proteintech, 31202-1-AP, Leiomodin-2 Polyclonal antibody

CATALOG NUMBER: 31202-1-AP
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Leiomodin-2 (31202-1-AP) by Proteintech is a Polyclonal antibody targeting Leiomodin-2 in WB, ELISA applications with reactivity to human, mouse, rat, pig samples 31202-1-AP targets Leiomodin-2 in WB, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: mouse skeletal muscle tissue, mouse tongue tissue, pig tongue tissue, rat skeletal muscle tissue, rat tongue tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Leiomodin-2 (Lmod2) is a striated muscle-specific actin-binding protein that plays a crucial role in the regulation of thin filament length and assembly in muscle cells. It is particularly important in cardiac and skeletal muscles. In the heart, Lmod2 is necessary for maintaining proper thin filament length, which is crucial for generating contractile force. Studies have shown that Lmod2 knockout in mice leads to dilated cardiomyopathy and rapid cardiac failure due to shorter and non-uniform thin filaments. Lmod2 is also essential for effective skeletal muscle contraction. Mutations or loss of Lmod2 can lead to significant impairments in muscle function. Mutations in the LMOD2 gene have been linked to severe neonatal and infantile dilated cardiomyopathy, a condition characterized by enlarged heart chambers and impaired contractility. Its observed molecular weight is 70-100 kDa. Specification Tested Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35312 Product name: Recombinant human LMOD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-120 aa of NM_207163.2 Sequence: MSTFGYRRGLSKYESIDEDELLASLSAEELKELERELEDIEPDRNLPVGLRQKSLTEKTPTGTFSREALMAYWEKESQKLLEKERLGECGKVAEDKEESEEELIFTESNSEVSEEVYTEE Predict reactive species Full Name: leiomodin 2 (cardiac) Calculated Molecular Weight: 62 kDa Observed Molecular Weight: 70-100 kDa GenBank Accession Number: NM_207163.2 Gene Symbol: LMOD2 Gene ID (NCBI): 442721 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q6P5Q4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924