Proteintech, 31264-1-AP, FOLR2 Polyclonal antibody

Size: 20ul / 150ul The FOLR2 (31264-1-AP) by Proteintech is a Polyclonal antibody targeting FOLR2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 31264-1-AP targets FOLR2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HT-1080 cells, Jurkat cells, MCF-7 cells, Raji cells, Ramos cells Positive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information FOLR2 (Folate Receptor 2), also known as Folate Receptor beta (FR-beta), is a 38 kDa glycoprotein that is anchored to the cell membrane via glycosyl phosphatidylinositol (GPI) linkage . FOLR2 belongs to the folate receptor (FOLR) family, which also includes FOLR1 (FR-α), FOLR3 (FR-γ), and FOLR4. FOLR2 has been shown to be expressed by malignant cells, including myelogenous leukemia cells, but has also been demonstrated to be mainly expressed by tumor-associated macrophages (TAMs). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg0953 Product name: recombinant human FOLR2 protein Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 17-228 aa of NM_000803.5 Sequence: TMCSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMH Predict reactive species Full Name: folate receptor 2 (fetal) Calculated Molecular Weight: 29KD Observed Molecular Weight: 33-35 kDa GenBank Accession Number: NM_000803.5 Gene Symbol: FOLR2 Gene ID (NCBI): 2350 RRID: AB_3669922 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P14207 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.