Iright
BRAND / VENDOR: Proteintech

Proteintech, 31344-1-AP, CFAP70 Polyclonal antibody

CATALOG NUMBER: 31344-1-AP
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CFAP70 (31344-1-AP) by Proteintech is a Polyclonal antibody targeting CFAP70 in IHC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples 31344-1-AP targets CFAP70 in IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IP detected in: mouse testis tissue Positive IHC detected in: rat testis tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse testis tissue Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information Cilia- and flagella-associated protein 70 (CFAP70) harbours eight tetratricopeptide repeats (TPRs) and bound tightly to the ciliary axoneme. CFAP70 is necessary to assemble spermatid flagella and could be used as a diagnostic target for male infertility with OAT in the clinic.CFAP70 is a novel regulatory component of the ODA in motile cilia and flagella, and that the N-terminus is important for its ciliary localization (PMID: 30158508). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35209 Product name: Recombinant human TTC18 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-200 aa of BC032856 Sequence: MEQVPSAGRLVQITVTEGYDLKGFKGDTPVTFIRAEFNQVVLGDSAKITVSPEGSAKYNFTSSFEFNPEGGITSDDLAHKPVFLTVTEVLPKEKKQKEEKTLILGQAVVDLLPLLEGQSSFQTTVPLHPVQGSPLETPRSSAKQCSLEVKVLVAEPLLTTAQISGGNLLKVTLEAAYSVPESFIPTGPGQNYMVGLQVPS Predict reactive species Full Name: tetratricopeptide repeat domain 18 Calculated Molecular Weight: 126 kDa Observed Molecular Weight: 126 kDa GenBank Accession Number: BC032856 Gene Symbol: TTC18 Gene ID (NCBI): 118491 RRID: AB_3669954 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5T0N1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924