Proteintech, 31391-1-AP, SBSPON Polyclonal antibody

Size: 20ul / 150ul The SBSPON (31391-1-AP) by Proteintech is a Polyclonal antibody targeting SBSPON in WB, ELISA applications with reactivity to Human samples 31391-1-AP targets SBSPON in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: human placenta tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: Human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34175 Product name: Recombinant human C8orf84 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 140-259 aa of BC042877 Sequence: AFNKERTRQATSPHWSTHTEDAGYCMEFKTESLTPHCALENWPLTRWMQYLREGYTVCVDCQPPAMNSVSLRCSGDGLDSDGNQTLHWQAIGNPRCQGTWKKVRRVDQCSCPAVHSFIFI Predict reactive species Full Name: chromosome 8 open reading frame 84 Calculated Molecular Weight: 264 aa, 30 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC042877 Gene Symbol: SBSPON Gene ID (NCBI): 157869 RRID: AB_3669961 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8IVN8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.