Proteintech, 31422-1-AP, NEK7 Polyclonal antibody

Size: 20ul / 150ul The NEK7 (31422-1-AP) by Proteintech is a Polyclonal antibody targeting NEK7 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 31422-1-AP targets NEK7 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: C6 cells, HeLa cells, Jurkat cells, NIH/3T3 cells Positive IHC detected in: mouse heart tissue, human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Mammalian NIMA-related kinases (NEKs) represent a family of serine/threonine kinases, named NEK1-NEK11, which are implicated in the control of several aspects of mitosis and are involved in non-mitotic functions (PMID: 33364979). NIMA-related kinase 7 (NEK7) is the smallest NIMA-related kinase (NEK) in mammals. NEK7 is identified as a highly conserved serine or threonine kinase, which is not only crucial for mitosis entry, cell cycle progression, cell division, and mitotic process, but also expressed in brain, heart, lung, liver, spleen, and other issues (PMID: 31787755). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33629 Product name: Recombinant human NEK7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-36 aa of NM_133494 Sequence: MDEQSQGMQGPPVPQFQPQKALRPDMGYNTLANFRI Predict reactive species Full Name: NIMA (never in mitosis gene a)-related kinase 7 Calculated Molecular Weight: 35 Observed Molecular Weight: 32-35 kDa GenBank Accession Number: NM_133494 Gene Symbol: NEK7 Gene ID (NCBI): 140609 RRID: AB_3669975 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8TDX7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.