Product Description
Size: 20ul / 150ul
The WASF2 (31442-1-AP) by Proteintech is a Polyclonal antibody targeting WASF2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples
31442-1-AP targets WASF2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: MDA-MB-231 cells, U2OS cells, K-562 cells, MCF-7 cells, PC-3 cells
Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: U2OS cells
Recommended dilution
Western Blot (WB): WB : 1:1000-1:6000
Immunohistochemistry (IHC): IHC : 1:200-1:800
Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
Background Information
WASF2 (WASp family Verprolin-homologous protein-2), also known as WAVE2, a member of the Wiskott-Aldrich syndrome protein (WASp) family of actin nucleation promoting factors, is a downstream effector molecule that implicates the signal transduction from small GTPases to the actin cytoskeleton, which can elongate the cell movement mode (PMID: 35849030,28332566). Moreover, WASF2 promoted the invasiveness of cancer cells by binding to actin cytoskeletal protein alpha-actinin 4 (ACTN4) (PMID: 30353690). The calculated MW of WASF2 is 54 kDa, with an isoform of 32 kDa, but the observed MW is about 80 kDa, which may be due to post-translational modification (PMID: 35849030,28332566,21383498,17389688,18362183,38391912).
Specification
Tested Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag35663 Product name: Recombinant human WASF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 182-315 aa of NM_006990.4 Sequence: KKDNPNRGNVNPRKIKTRKEEWEKMKMGQEFVESKEKLGTSGYPPTLVYQNGSIGCVENVDASSYPPPPQSDSASSPSPSFSEDNLPPPPAEFSYPVDNQRGSGLAGPKRSSVVSPSHPPPAPPLGSPPGPKPG Predict reactive species
Full Name: WAS protein family, member 2
Calculated Molecular Weight: 54kDa,498aa
Observed Molecular Weight: 80 kDa
GenBank Accession Number: NM_006990.4
Gene Symbol: WASF2
Gene ID (NCBI): 10163
RRID: AB_3669985
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity Purification
UNIPROT ID: Q9Y6W5
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924