Proteintech, 31475-1-AP, EPPK1 Polyclonal antibody

Size: 20ul / 150ul The EPPK1 (31475-1-AP) by Proteintech is a Polyclonal antibody targeting EPPK1 in WB, IHC, ELISA applications with reactivity to human samples 31475-1-AP targets EPPK1 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: L02 cells Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information Epplakin 1 (EPPK1), belonging to the plakin family, is involved in connecting intermediate filaments and regulating their reorganization in stress response. Studies have shown that EPPK1 is involved in the progression of various cancers, such as liver cancer, cervical cancer, and bladder urothelial carcinoma. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35749 Product name: Recombinant human EPPK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1400-1570 aa of NM_031308.3 Sequence: NKFFFDPSARDQVTYQQLRERCVCDSETGLLLLPLPSDTVLEVDDHTAVALRAMKVPVSTGRFKGCSVSLWDLLLSEYVGADKRRELVALCRSGRAAALRQVVSAVTTLVEAAERQPLQATFRGLRKQVSARDLFRAQLISRKTLDELSQGTTTVKEVAEMDSVKRSLEGG Predict reactive species Full Name: epiplakin 1 Calculated Molecular Weight: 555 kDa Observed Molecular Weight: 500-600 kDa GenBank Accession Number: NM_031308.3 Gene Symbol: EPPK1 Gene ID (NCBI): 83481 RRID: AB_3669999 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P58107 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.