Proteintech, 31565-1-AP, COMTD1 Polyclonal antibody

Size: 20ul / 150ul The COMTD1 (31565-1-AP) by Proteintech is a Polyclonal antibody targeting COMTD1 in WB, ELISA applications with reactivity to Human, rat, mouse samples 31565-1-AP targets COMTD1 in WB, ELISA applications and shows reactivity with Human, rat, mouse samples. Tested Applications Positive WB detected in: rat cerebellum tissue, NIH/3T3 cells, SK-BR-3 cells, rat pancreas tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information COMTD1 is associated with mitochondrial fractions of several cell types. COMTD1 is ubiquitously expressed in humans and mice but is expressed most highly in the gall bladder, small intestine, parathyroid gland, and renal tubes of the kidney (PMID: 37068079). Specification Tested Reactivity: Human, rat, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35997 Product name: Recombinant human COMTD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 33-262 aa of BC023663 Sequence: RRCPPWRGRREQCLLPPEDSRLWQYLLSRSMREHPALRSLRLLTLEQPQGDSMMTCEQAQLLANLARLIQAKKALDLGTFTGYSALALALALPADGRVVTCEVDAQPPELGRPLWRQAEAEHKIDLRLKPALETLDELLAAGEAGTFDVAVVDADKENCSAYYERCLQLLRPGGILAVLRVLWRGKVLQPPKGDVAAECVRNLNERIRRDVRVYISLLPLGDGLTLAFKI Predict reactive species Full Name: catechol-O-methyltransferase domain containing 1 Observed Molecular Weight: 30 kDa GenBank Accession Number: BC023663 Gene Symbol: COMTD1 Gene ID (NCBI): 118881 RRID: AB_3670037 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q86VU5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.