Proteintech, 31585-1-AP, DPEP3 Polyclonal antibody

Size: 20ul / 150ul The DPEP3 (31585-1-AP) by Proteintech is a Polyclonal antibody targeting DPEP3 in WB, ELISA applications with reactivity to human samples 31585-1-AP targets DPEP3 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Dipeptidase 3 (DPEP3) is a member of the dipeptidase family. It is normally expressed restricted to the testis and is involved in the hydrolytic metabolism of dipeptides (PMID: 32325220). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36039 Product name: Recombinant human DPEP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 30-93 aa of NM_001370198.1 Sequence: RQPVTRAETTPGAPRALSTLGSPSLFTTPGVPSALTTPGLTTPGTPKTLDLRGRAQALMRSFPLVDG Predict reactive species Full Name: dipeptidase 3 Calculated Molecular Weight: 54kDa，488aa Observed Molecular Weight: 50 kDa GenBank Accession Number: NM_001370198.1 Gene Symbol: DPEP3 Gene ID (NCBI): 64180 RRID: AB_3670045 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9H4B8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.