Proteintech, 31630-1-AP, EIF3F Polyclonal antibody

Size: 20ul / 150ul The EIF3F (31630-1-AP) by Proteintech is a Polyclonal antibody targeting EIF3F in WB, ELISA applications with reactivity to human, mouse, rat samples 31630-1-AP targets EIF3F in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, mouse liver tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information EIF3F (eukaryotic translation initiation factor 3 subunit F) is a protein that plays an important role in eukaryotic cells and is an integral part of the translation initiation factor 3(Eif3) complex. EIF3 is a complex of at least 10 distinct subunits and is the largest translation initiation factor in eukaryotes. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34849 Product name: Recombinant human EIF3F protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 105-357 aa of BC000490 Sequence: SYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTSLQNGRMSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQDALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDFETMLNSNINDLLMVTYLANLTQSQIALNEKLVNL Predict reactive species Full Name: eukaryotic translation initiation factor 3, subunit F Calculated Molecular Weight: 38 kDa Observed Molecular Weight: 40-45 kDa GenBank Accession Number: BC000490 Gene Symbol: EIF3F Gene ID (NCBI): 8665 RRID: AB_3670056 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: O00303 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.