Iright
BRAND / VENDOR: Proteintech

Proteintech, 31647-1-AP, C12orf29 Polyclonal antibody

CATALOG NUMBER: 31647-1-AP
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The C12orf29 (31647-1-AP) by Proteintech is a Polyclonal antibody targeting C12orf29 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 31647-1-AP targets C12orf29 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HL-60 cells, HeLa cells, U-87 MG cells Positive IHC detected in: mouse small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information C12orf29, also known as RLIG1, is a 37 kDa human protein consisting of 325 amino acids. It catalyzes ATP-dependent RNA ligation via a three-step mechanism involving tandem auto- and RNA AMPylation (PMID: 36792600). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35681 Product name: Recombinant human C12orf29 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-150 aa of NM_001009894.2 Sequence: MKRLGSVQRKMPCVFVTEVKEEPSSKREHQPFKVLATETVSHKALDADIYSAIPTEKVDGTCCYVTTYKDQPYLWARLDRKPNKQAEKRFKNFLHSKENPKEFFWNVEEDFKPAPECWIPAKETEQINGNPVPDENGHIPGWVPVEKNNK Predict reactive species Full Name: chromosome 12 open reading frame 29 Calculated Molecular Weight: 37kDa,325aa Observed Molecular Weight: 37 kDa GenBank Accession Number: NM_001009894.2 Gene Symbol: C12orf29 Gene ID (NCBI): 91298 RRID: AB_3670063 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8N999 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924