Proteintech, 31665-1-AP, CDC40 Polyclonal antibody

Size: 20ul / 150ul The CDC40 (31665-1-AP) by Proteintech is a Polyclonal antibody targeting CDC40 in WB, ELISA applications with reactivity to human samples 31665-1-AP targets CDC40 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293T cells, HUVEC cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information CDC40 (cell division cycle 40), also known as EHB3. It is expected to be located in the nucleus, which is ubiquitinated in bone marrow and lymph node. The protein is required for pre-mRNA splicing as component of the activated spliceosome, and it plays an important role in embryonic brain development; this function does not require proline isomerization (PMID: 33220177; 33220177). The molecular weight of CDC40 is 65 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36151 Product name: Recombinant human CDC40 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 50-243 aa of BC126114 Sequence: LAVAVDSAPEVAVKEDLETGVHLDPAVKEVQYNPTYETMFAPEFGPENPFRTQQMAAPRNMLSGYAEPAHINDFMFEQQRRTFATYGYALDPSLDNHQVSAKYIGSVEEAEKNQGLTVFETGQKKTEKRKKFKENDASNIDGFLGPWAKYVDEKDVAKPSEEEQKELDEITAKRQKKGKQEEEKPGEEKTILHV Predict reactive species Full Name: cell division cycle 40 homolog (S. cerevisiae) Observed Molecular Weight: 65-70 kDa GenBank Accession Number: BC126114 Gene Symbol: CDC40 Gene ID (NCBI): 51362 RRID: AB_3670068 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: O60508 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.