Product Description
Size: 20ul / 150ul
The ATP2B3/PMCA3 (31692-1-AP) by Proteintech is a Polyclonal antibody targeting ATP2B3/PMCA3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples
31692-1-AP targets ATP2B3/PMCA3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: 37°C incubated mouse brain tissue, 37°C incubated rat brain tissue
Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:1000-1:8000
Immunohistochemistry (IHC): IHC : 1:500-1:2000
Background Information
ATP2B3 also known as PMCA3, belongs to the family of P-type primary ion transport ATPases. ATP2B3 uses ATP as an energy source to transport cytosolic Ca2+ ions across the plasma membrane to the extracellular compartment. ATP2B3 is highly expressed in the brain and cerebellum and is important in regulating neuronal Ca2+. Mutations in ATP2B3 are associated with X-linked spinocerebellar ataxia-1 (PMID: 25953895, 22912398).
Specification
Tested Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag35923 Product name: Recombinant human ATP2B3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-97 aa of BC047580 Sequence: MGDMANSSIEFHPKPQQQRDVPQAGGFGCTLAELRTLMELRGAEALQKIEEAYGDVSGLCRRLKTSPTEGLADNTNDLEKRRQIYGQNFIPPKQPKT Predict reactive species
Full Name: ATPase, Ca++ transporting, plasma membrane 3
Observed Molecular Weight: 134 kDa
GenBank Accession Number: BC047580
Gene Symbol: ATP2B3
Gene ID (NCBI): 492
RRID: AB_3670080
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity Purification
UNIPROT ID: Q16720
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924