Proteintech, 31696-1-AP, DCUN1D2 Polyclonal antibody

Size: 20ul / 150ul The DCUN1D2 (31696-1-AP) by Proteintech is a Polyclonal antibody targeting DCUN1D2 in IP, ELISA applications with reactivity to human samples 31696-1-AP targets DCUN1D2 in IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive IP detected in: PC-12 cells Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information DCUN1D2 (DCN1-like protein 2), also known as DCNL2. It is predicted to be located in the cytoplasm and nucleus. Mostly expressed in liver, kidney and brain (PMID: 26906416). Contributes to the neddylation of all cullins by transferring NEDD8 from N-terminally acetylated NEDD8-conjugating E2s enzyme to different cullin C-terminal domain-RBX complexes and plays an essential role in the regulation of SCF (SKP1-CUL1-F-box protein)-type complexes activity (PMID: 19617556). The molecular weight of DCUN1D2 is 30 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36310 Product name: Recombinant human DCUN1D2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 16-73 aa of BC056669 Sequence: MACTQAGERTAIYCLTQNEWRLDEATDSFFQNPDSLHRESMRNAVDKKKLERLYGRYK Predict reactive species Full Name: DCN1, defective in cullin neddylation 1, domain containing 2 (S. cerevisiae) Observed Molecular Weight: 30 kDa GenBank Accession Number: BC056669 Gene Symbol: DCUN1D2 Gene ID (NCBI): 55208 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q6PH85 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.