Proteintech, 31704-1-AP, CSDA Polyclonal antibody

Size: 20ul / 150ul The CSDA (31704-1-AP) by Proteintech is a Polyclonal antibody targeting CSDA in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 31704-1-AP targets CSDA in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse heart tissue, KYSE-30 cells, mouse liver tissue, mouse skeletal muscle tissue Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information CSDA (Cold shock domain protein A), also known as DBPA (DNA-binding protein A), YBX3 (Y-box protein 3), is a DNA-binding protein that represses angiogenesis and lymphangiogenesis by directly binding to hypoxia response element (HRE) and serum response element (SRE). CSDA is ubiquitous expressed in human skeletal muscle, heart, and decidual cells, which is thought to a multifunctional epithelial-specific protein involved in gene transcription, DNA repair, and interaction with other proteins (PMID: 33816248). CSDA is a nucleic-acid-binding protein that directly regulates gene expression by using different mechanisms, and acts as a translational repressor (e.g., MYH9 and SPTBN1) and positive regulator of mRNA stability (PMID: 31189097). Western blot analysis detected CDSA at a range of 50~70 kDa due to the anomalous mobility of Y-box proteins (PMID: 38255791). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36519 Product name: Recombinant human CSDA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 78-175 aa of BC008801 Sequence: GSEDAEKKVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYAADRR Predict reactive species Full Name: cold shock domain protein A Calculated Molecular Weight: 40 kDa Observed Molecular Weight: 60-68 kDa GenBank Accession Number: BC008801 Gene Symbol: CSDA Gene ID (NCBI): 8531 RRID: AB_3670088 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P16989 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.