Iright
BRAND / VENDOR: Proteintech

Proteintech, 31728-1-AP, TMEM208 Polyclonal antibody

CATALOG NUMBER: 31728-1-AP
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TMEM208 (31728-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM208 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 31728-1-AP targets TMEM208 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: 37°C incubated mouse brain tissue, 37°C incubated rat brain tissue Positive IHC detected in: mouse stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information Transmembrane protein 208 (TMEM208) can regulate both autophagy and ER stress. When overexpressed, TMEM208 impaired autophagy as characterized by the decrease of the accumulation of LC3-II, decreased degradation of autophagic substrates, and reduced expression of critical effectors and vital molecules of the ER stress and autophagy processes. (PMID: 23691174) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35668 Product name: Recombinant human TMEM208 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 130-173 aa of BC003080 Sequence: PGRALYLLWVNVLGPWFTADSGTPAPEHNEKRQRRQERRQMKRL Predict reactive species Full Name: transmembrane protein 208 Calculated Molecular Weight: 173 aa, 20 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC003080 Gene Symbol: TMEM208 Gene ID (NCBI): 29100 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BTX3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924