Proteintech, 31790-1-AP, ZFP42 Polyclonal antibody

Size: 20ul / 150ul The ZFP42 (31790-1-AP) by Proteintech is a Polyclonal antibody targeting ZFP42 in WB, ELISA applications with reactivity to human samples 31790-1-AP targets ZFP42 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HL-60 cells, LNCaP cells, PC-3 cells, Raji cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information The ZFP42, also known as REX1, is a transcriptional regulator and a member of the zinc finger protein family. It is specifically highly expressed in pluripotent stem cells, such as embryonic stem cells, and is one of the key molecules for maintaining cell pluripotency and self-renewal capacity. Its expression level rapidly declines with cell differentiation, making it widely used as a reliable marker for the pluripotent state. Studies have shown that ZFP42 is involved in inhibiting differentiation programs and maintaining stemness by regulating the transcription of downstream target genes. Additionally, its abnormal expression in various tumors suggests that it may be involved in tumorigenesis and development, making it an important subject in the research of regenerative medicine, developmental biology, and oncology. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36112 Product name: Recombinant human ZFP42 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-172 aa of BC160056 Sequence: MSQQLKKRAKTRHQKGLGGRAPSGAKPRQGKSSQDLQAEIEPVSAVWALCDGYVCYEPGPQALGGDDFSDCYIECVIRGEFSQPILEEDSLFESLEYLKKGSEQQLSQKVFEASSLECSLEYMKKGVKKELPQKIVGENSLE Predict reactive species Full Name: zinc finger protein 42 homolog (mouse) Observed Molecular Weight: 47 kDa GenBank Accession Number: BC160056 Gene Symbol: ZFP42 Gene ID (NCBI): 132625 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q96MM3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.