Proteintech, 31793-1-AP, PON3 Polyclonal antibody

Size: 20ul / 150ul The PON3 (31793-1-AP) by Proteintech is a Polyclonal antibody targeting PON3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 31793-1-AP targets PON3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, HepG2 cells, mouse liver tissue, rat liver tissue Positive IHC detected in: human liver tissue, mouse liver tissue, rat liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information PON3, a member of the paraoxonase family, is expressed primarily in the liver and encodes a protein that is secreted into the bloodstream and binds to high-density lipoprotein (HDL). It also rapidly hydrolyzes lactones and inhibits the oxidation of low-density lipoprotein (LDL), thereby slowing the onset and progression of atherosclerosis. In addition, PON3 is closely associated with hepatocellular carcinoma (HCC), and is a potential therapeutic target for HCC by inducing cell cycle arrest and further inhibiting HCC cell proliferation. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36602 Product name: Recombinant human PON3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 23-167 aa of NM_000940.2 Sequence: AFRERVNASREVEPVEPENCHLIEELESGSEDIDILPSGLAFISSGLKYPGMPNFAPDEPGKIFLMDLNEQNPRAQALEISGGFDKELFNPHGISIFIDKDNTVYLYVVNHPHMKSTVEIFKFEEQQRSLVYLKTIKHELLKSVN Predict reactive species Full Name: paraoxonase 3 Calculated Molecular Weight: NM_000940.2 40kDa，354aa Observed Molecular Weight: 40 kDa GenBank Accession Number: NM_000940.2 Gene Symbol: PON3 Gene ID (NCBI): 5446 RRID: AB_3670115 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q15166 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.