Proteintech, 31840-1-AP, TATDN1 Polyclonal antibody

Size: 20ul / 150ul The TATDN1 (31840-1-AP) by Proteintech is a Polyclonal antibody targeting TATDN1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 31840-1-AP targets TATDN1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A431 cells, BEAS-2B cells, A431 cell, A549 cell Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Homo sapiens TatD DNase domain containing 1 (TATDN1), a member of the TATD family, is a highly conserved nuclease in both prokaryotes and eukaryotes with depurine/apyrimidine (AP) endonuclease activity, which plays an extremely important role in the genesis and prognosis of malignant tumors such as NSCLC and breast cancer, and is a potential therapeutic target for NSCLC patients who have failed to undergo cisplatin therapy (DDP) in vivo. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36040 Product name: Recombinant human TATDN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-200 aa of BC064964 Sequence: MSRFKFIDIGINLTDPMFRGIYRGVQKHQDDLQDVIGRAVEIGVKKFMITGGNLQDSKDALHLAQTNGMFFSTVGCHPTRCGEFEKNNPDLYLKELLNLAENNKGKVVAIGECGLDFDRLQFCPKDTQLKYFEKQFELSEQTKLPMFLHCRNSHAEFLDITKRNRDRCVGGVVHSFDGTKEAAAALIDLDLYIGFNGCSL Predict reactive species Full Name: TatD DNase domain containing 1 Observed Molecular Weight: 30 kDa GenBank Accession Number: BC064964 Gene Symbol: TATDN1 Gene ID (NCBI): 83940 RRID: AB_3670124 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q6P1N9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.