Proteintech, 31887-1-AP, CD79a Polyclonal antibody

Size: 20ul / 150ul The CD79a (31887-1-AP) by Proteintech is a Polyclonal antibody targeting CD79a in WB, IHC, IF-P, ELISA applications with reactivity to mouse, rat samples 31887-1-AP targets CD79a in WB, IHC, IF-P, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: mouse spleen tissue Positive IHC detected in: mouse spleen tissue, rat spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: rat spleen tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information CD79a, also named as B-cell antigen receptor complex-associated protein alpha chain or MB-1 membrane glycoprotein, is a 226 amino acid protein, which contains one ITAM domain and one Ig-like C2-type (immunoglobulin-like) domain. CD79A is expressed in B cell and localizes in the cell membrane. CD79A is required in cooperation with CD79B for initiation of the signal transduction cascade activated by binding of antigen to the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. CD79A is also required for BCR surface expression and for efficient differentiation of pro- and pre-B-cells. Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg1388 Product name: Recombinant Mouse CD79A protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 29-137 aa of NM_007655.3 Sequence: LRVEGGPPSLTVNLGEEARLTCENNGRNPNITWWFSLQSNITWPPVPLGPGQGTTGQLFFPEVNKNHRGLYWCQVIENNILKRSCGTYLRVRNPVPRPFLDMGEGTKNR Predict reactive species Full Name: CD79A antigen (immunoglobulin-associated alpha) Calculated Molecular Weight: 25 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: NM_007655.3 Gene Symbol: Cd79a Gene ID (NCBI): 12518 RRID: AB_3670132 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P11911 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.