Proteintech, 31907-1-AP, PABPC1L Polyclonal antibody

Size: 20ul / 150ul The PABPC1L (31907-1-AP) by Proteintech is a Polyclonal antibody targeting PABPC1L in WB, ELISA applications with reactivity to human, mouse, rat samples 31907-1-AP targets PABPC1L in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: RAW 264.7 cells, mouse kidney tissue, mouse liver tissue, rat liver tissue, NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information PAP1L, also known as PABPC1L, is a human gene that has been associated with various cellular processes, particularly in the context of reproduction and embryonic development. PABPC1L was markedly upregulated in RCC, and high PABPC1L expression correlated with unfavorable prognosis and resistance to ICB (PMID: 38382068). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36248 Product name: Recombinant human PABPC1L protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 350-530 aa of NM_001124756 Sequence: RLSTMRTLSNPLLGSFQQPSSYFLPAMPQPPAQAAYYGCGPVTPTQPAPRWTSQPPRPSCASMVRPPVVPRRPPAHISSVRQASTQVPRTVPHTQRVANIGTQTTGPSGVGCCTPGRPLLPCKCSSAAHSTYRVQEPAVHIPGQEP Predict reactive species Full Name: poly(A) binding protein, cytoplasmic 1-like Calculated Molecular Weight: 68 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: NM_001124756 Gene Symbol: PABPC1L Gene ID (NCBI): 80336 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.