Proteintech, 31951-1-AP, IFNGR1/CD119 Polyclonal antibody

Size: 20ul / 150ul The IFNGR1/CD119 (31951-1-AP) by Proteintech is a Polyclonal antibody targeting IFNGR1/CD119 in WB, IP, ELISA applications with reactivity to mouse samples 31951-1-AP targets IFNGR1/CD119 in WB, IP, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: EL-4 cells Positive IP detected in: EL-4 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information Interferon-gamam (IFN-γ) is a cytokine critical for innate and adaptive immunity against viral and intracellular bacterial infections and for tumor control. Cellular responses to IFN-γ are activated through its interaction with a heterodimeric receptor consisting of two subunits, IFNGR1 (CD119) and IFNGR2. IFNGR1 is the ligand-binding subunit which binds IFN-γ with high affinity, whereas IFNGR2 serves as the accessory subunit. Two subunits bind one IFN-γ dimer. Defects in IFNGR1 are a cause of mendelian susceptibility to mycobacterial disease (MSMD), also known as familial disseminated atypical mycobacterial infection. (PMID: 17981204; 946248; 10888113) Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg1536 Product name: Recombinant Mouse IFN-gamma R1/IFNGR1 protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 26-254 aa of NM_010511.3 Sequence: ALTSTEDPEPPSVPVPTNVLIKSYNLNPVVCWEYQNMSQTPIFTVQVKVYSGSWTDSCTNISDHCCNIYEQIMYPDVSAWARVKAKVGQKESDYARSKEFLMCLKGKVGPPGLEIRRKKEEQLSVLVFHPEVVVNGESQGTMFGDGSTCYTFDYTVYVEHNRSGEILHTKHTVEKEECNETLCELNISVSTLDSRYCISVDGISSFWQVRTEKSKDVCIPPFHDDRKDS Predict reactive species Full Name: interferon gamma receptor 1 Calculated Molecular Weight: 52kDa Observed Molecular Weight: 90 kDa GenBank Accession Number: NM_010511.3 Gene Symbol: Ifngr1 Gene ID (NCBI): 15979 RRID: AB_3670157 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P15261 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.