Proteintech, 31970-1-AP, KBTBD8 Polyclonal antibody

Size: 20ul / 150ul The KBTBD8 (31970-1-AP) by Proteintech is a Polyclonal antibody targeting KBTBD8 in WB, ELISA applications with reactivity to human samples 31970-1-AP targets KBTBD8 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Daudi cells, RKO cells, U-118 MG cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information Kelch repeat and BTB domain containing 8 (KBTBD8, also known as TAKRP and TA-KRP) is a member of the BTB-kelch family of proteins, which is specifically localized at the Golgi apparatus in nondividing cells and becomes restricted to the spindle apparatus upon mitosis (PMID: 23578279). KBTBD family proteins are involved in ubiquitination in various cells and tissues and are correlated with human muscle diseases (PMID: 9878064; 16547521; 24959344). The expression level of KBTBD8 might affect the proliferation and migration of epithelial ovarian cancer (PMID: 33109073). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36219 Product name: Recombinant human KBTBD8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 165-420 aa of NM_032505.2 Sequence: QELGDRSKEYIRKKFLCVTKEQEFLQLTKDQLISILDSDDLNVDREEHVYESIIRWFEHEQNEREVHLPEIFAKCIRFPLMEDTFIEKIPPQFAQAIAKSCVEKGPSNTNGCTQRLGMTASEMIICFDAAHKHSGKKQTVPCLDIVTGRVFKLCKPPNDLREVGILVSPDNDIYIAGGYRPSSSEVSIDHKAENDFWMYDHSTNRWLSKPSLLRARIGCKLVYCCGKMYAIGGRVYEGDGRNSLKSVECYDSRENC Predict reactive species Full Name: kelch repeat and BTB (POZ) domain containing 8 Calculated Molecular Weight: 69 kDa，601aa Observed Molecular Weight: 60 kDa GenBank Accession Number: NM_032505.2 Gene Symbol: KBTBD8 Gene ID (NCBI): 84541 RRID: AB_3670161 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8NFY9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.