Proteintech, 32038-1-AP, AMN Polyclonal antibody

Size: 20ul / 150ul The AMN (32038-1-AP) by Proteintech is a Polyclonal antibody targeting AMN in WB, IF/ICC, ELISA applications with reactivity to human samples 32038-1-AP targets AMN in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HuH-7 cells, Jurkat cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Amnion associated transmembrane protein (AMN, also known as IGS2, PRO1028, and amnionless) is a 45-50 kDa cysteine-rich type I transmembrane protein that is expressed exclusively in the extra-embryonic visceral endoderm layer during gastrulation (PMID: 17990981; 11279523). It may direct the production of trunk mesoderm derived from the middle streak by acting in the underlying visceral endoderm to modulate a BMP signaling pathway (PMID: 11279523). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35205 Product name: Recombinant human AMN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 20-204 aa of NM_030943.3 Sequence: VSKLWVPNTDFDVAANWSQNRTPCAGGAVEFPADKMVSVLVQEGHAVSDMLLPLDGELVLASGAGFGVSDVGSHLDCGAGEPAVFRDSDRFSWHDPHLWRSGDEAPGLFFVDAERVPCRHDDVFFPPSASFRVGLGPGASPVRVRSISALGRTFTRDEDLAVFLASRAGRLRFHGPGALSVGPED Predict reactive species Full Name: amnionless homolog (mouse) Calculated Molecular Weight: 48 kDa Observed Molecular Weight: 48 kDa GenBank Accession Number: NM_030943.3 Gene Symbol: AMN Gene ID (NCBI): 81693 RRID: AB_3670177 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9BXJ7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.