Proteintech, 32075-1-AP, FRY Polyclonal antibody

Size: 20ul / 150ul The FRY (32075-1-AP) by Proteintech is a Polyclonal antibody targeting FRY in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 32075-1-AP targets FRY in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: THP-1 cells, RT-4 cells Positive IHC detected in: human pancreas cancer tissue, human urothelial carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: THP-1 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:150-1:600 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information The FRY gene encodes a protein involved in cell cycle regulation and DNA damage response. It plays a crucial role in the G2/M checkpoint, ensuring cells complete DNA repair before entering mitosis by activating the ATR-CHK1 signaling pathway. FRY is expressed in various tissues, including brain, liver, and testis, with notable expression in Sertoli and spermatogonial cells. Aberrant FRY function is associated with multiple diseases, such as cancer and neurodegenerative disorders. In cancer cells, FRY expression can influence proliferation and survival. Understanding FRY's role in cell cycle control and genome stability is vital for elucidating disease mechanisms and developing targeted therapies. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34959 Product name: Recombinant human FRY protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2534-2680 aa of NM_023037 Sequence: LEHSDLIMTLSPSEETNPMELLTTACDSTPAEPHSFNTRMSSFDASLPDMNNLQISEGSKAEAVREEEDTTVHEDDLSSSINELPAAFECSDSFSLDMTEGEEKGNRALDQFTLASFGEGDRGVSPPPSPFFSAILAAFQPAACDDA Predict reactive species Full Name: furry homolog (Drosophila) Calculated Molecular Weight: 339 kDa Observed Molecular Weight: 340 kDa GenBank Accession Number: NM_023037 Gene Symbol: FRY Gene ID (NCBI): 10129 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q5TBA9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.