Proteintech, 32079-1-AP, ESM1 Polyclonal antibody

Size: 20ul / 150ul The ESM1 (32079-1-AP) by Proteintech is a Polyclonal antibody targeting ESM1 in WB, ELISA applications with reactivity to human samples 32079-1-AP targets ESM1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HUVEC cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information ESM1, also known as endothelial cell-specific molecule 1 or endocan, is a protein-coding gene that encodes a secreted protein. It is primarily expressed in endothelial cells of human lung and kidney tissues, and its expression is regulated by cytokines, suggesting a role in endothelium-dependent pathological disorders. ESM1 has been implicated in various diseases, including gastric cancer, hypertension, and cervical cancer. In cervical cancer, ESM1 is overexpressed and acts as an independent prognostic factor associated with poor clinical outcomes. It promotes carcinoma angiogenesis and cervical squamous cell carcinoma progression through the VEGF/ERK signaling pathway. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36144 Product name: Recombinant human ESM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 100-184 aa of BC011989 Sequence: KDCPYGTFGMDCRETCNCQSGICDRGTGKCLKFPFFQYSVTKSSNRFVSLTEHDMASGDGNIVREEVVKENAAGSPVMRKWLNPR Predict reactive species Full Name: endothelial cell-specific molecule 1 Calculated Molecular Weight: 184 aa, 20 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC011989 Gene Symbol: ESM1 Gene ID (NCBI): 11082 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9NQ30 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.