Iright
BRAND / VENDOR: Proteintech

Proteintech, 32229-1-AP, ZNF683 Polyclonal antibody

CATALOG NUMBER: 32229-1-AP
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ZNF683 (32229-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF683 in WB, ELISA applications with reactivity to human, mouse samples 32229-1-AP targets ZNF683 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HepG2 cells, NK-92 cells, RAW 264.7 cells, Raji cells, mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information Zinc finger protein 683 (ZNF683, also known as Hobit) is a transcription factor that mediates a transcriptional program in various innate and adaptive immune tissue-resident lymphocyte T-cell types such as tissue-resident memory T (Trm) and natural killer cells (PMID: 36869093; 28555134; 36245253). It probably is a cancer-specific Trms marker (PMID: 36869093). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37412 Product name: Recombinant human ZNF683 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-296 aa of BC028731 Sequence: MALGGTGGSLSPSLDFQLFRGDQVFSACRPLPDMVDAHGPSCASWLCPLPLAPGRSALLACLQDLDLNLCTPQPAPLGTDLQGLQEDALSMKHEPPGLQASSTDDKKFTVKYPQNKDKLGKQPERAGEGAPCPAFSSHNSSSPPPLQNRKSPSPLAFCPCPPVNSISKELPFLLHAFYPGYPLLLPPPHLFTYGALPSDQCPHLLMLPQDPSYPTMAMPSLLMMVNELGHPSARWETLLPYPGAFQASGQALPSQARNPGAGAAPTDSPGLERGGMASPAKRVPLSSQTGTAALPY Predict reactive species Full Name: zinc finger protein 683 Calculated Molecular Weight: 57 kDa Observed Molecular Weight: 57 kDa GenBank Accession Number: BC028731 Gene Symbol: ZNF683 Gene ID (NCBI): 257101 RRID: AB_3670226 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8IZ20 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924