Iright
BRAND / VENDOR: Proteintech

Proteintech, 32251-1-AP, TMEM38B Polyclonal antibody

CATALOG NUMBER: 32251-1-AP
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TMEM38B (32251-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM38B in WB, ELISA applications with reactivity to human samples 32251-1-AP targets TMEM38B in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells, LNCaP cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information TMEM38B encodes endoplasmic reticulum membrane monovalent cation-specific channel which is involved in the release of calcium (Ca2+) from intracellular stores. TMEM38B, also known as TRIC-B, is one of the two trimeric intracellular cation (TRIC) channels. TRIC-B deficiency causes bone disease due to defective Ca2+ release and signaling in the bone cells. (PMID: 34036147, PMID: 39385871) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37754 Product name: Recombinant human TMEM38B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 228-291 aa of BC000049 Sequence: TSTMTFAPFEDTLSWMLFGWQQPFSSCEKKSEAKSPSNGVGSLASKPVDVASDNVKKKHTKKNE Predict reactive species Full Name: transmembrane protein 38B Calculated Molecular Weight: 291 aa, 33 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC000049 Gene Symbol: TMEM38B Gene ID (NCBI): 55151 RRID: AB_3670229 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9NVV0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924