Proteintech, 32282-1-AP, CAND1 Polyclonal antibody

Size: 20ul / 150ul The CAND1 (32282-1-AP) by Proteintech is a Polyclonal antibody targeting CAND1 in WB, IP, ELISA applications with reactivity to human samples 32282-1-AP targets CAND1 in WB, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells, MDA-MB-231 cells Positive IP detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information CAND1 (Cullin-Associated and Neddylation-Dissociated 1) is a key regulatory protein involved in the proper functioning of the CRL (Cullin-RING ubiquitin ligase) family, which plays a crucial role in ubiquitin-mediated protein degradation (PMID: 18444905). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35297 Product name: Recombinant human CAND1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 396-586 aa of NM_018448 Sequence: HAYLSLLKQTRPVQSWLCDPDAMEQGETPLTMLQSQVPNIVKALHKQMKEKSVKTRQCCFNMLTELVNVLPGALTQHIPVLVPGIIFSLNDKSSSSNLKIDALSCLYVILCNHSPQVFHPHVQALVPPVVACVGDPFYKITSEALLVTQQLVKVIRPLDQPSSFDATPYIKDLFTCTIKRLKAADIDQEVK Predict reactive species Full Name: cullin-associated and neddylation-dissociated 1 Calculated Molecular Weight: 136 kDa Observed Molecular Weight: 120 kDa GenBank Accession Number: NM_018448 Gene Symbol: CAND1 Gene ID (NCBI): 55832 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q86VP6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.