Product Description
Size: 20ul / 150ul
The CD42c (32462-1-AP) by Proteintech is a Polyclonal antibody targeting CD42c in WB, ELISA applications with reactivity to human samples
32462-1-AP targets CD42c in WB, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: human peripheral blood platelets
Recommended dilution
Western Blot (WB): WB : 1:1000-1:4000
Background Information
CD42c, also known as platelet glycoprotein Ib beta chain (GP1BB), is a transmembrane protein containing a leucine-rich amino acid sequence (PMID: 3353370). CD42c is covalently linked to platelet glycoprotein Ib alpha chain (CD42b/GP1BA) to form GPIb, which is part of the Glycoprotein Ib-V-IX receptor (GPIb-V-IX) complex that constitutes the receptor for von Willebrand factor (VWF), and mediates platelet adhesion (PMID: 7660135). Mutations in the GP1BB gene have been associated with Bernard-Soulier syndrome, velocardiofacial syndrome, and giant platelet disorder.
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag36521 Product name: Recombinant human GP1BB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 27-147 aa of NM_000407.4 Sequence: PAPCSCAGTLVDCGRRGLTWASLPTAFPVDTTELVLTGNNLTALPPGLLDALPALRTAHLGANPWRCDCRLVPLRAWLAGRPERAPYRDLRCVAPPALRGRLLPYLAEDELRAACAPGPLC Predict reactive species
Full Name: glycoprotein Ib (platelet), beta polypeptide
Calculated Molecular Weight: 22kDa,206aa
Observed Molecular Weight: 26 kDa
GenBank Accession Number: NM_000407.4
Gene Symbol: CD42c
Gene ID (NCBI): 2812
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity Purification
UNIPROT ID: P13224
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924