Proteintech, 32581-1-AP, ZSCAN2 Polyclonal antibody

Size: 20ul / 150ul The ZSCAN2 (32581-1-AP) by Proteintech is a Polyclonal antibody targeting ZSCAN2 in WB, ELISA applications with reactivity to human samples 32581-1-AP targets ZSCAN2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information Zinc finger and SCAN domain-containing protein 2 (ZSCAN2, also known as ZFP29 and ZNF854) plays an important role in the maintenance of the SSC (spermatogonial stem cells) pool in vitro and is integral for robust regeneration of spermatogenesis in vivo following exposure to clastogens. Loss of ZSCAN2 expression alters key cellular processes in undifferentiated spermatogonia, such as translation, chromatin modification, and ubiquitin conjugation (PMID: 35244684). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38126 Product name: Recombinant human ZSCAN2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-200 aa of BC136342 Sequence: MMAADIPRVTTPLSSLVQVPQEEDRQEEEVTTMILEDDSWVQEAVLQEDGPESEPFPQSAGKGGPQEEVTRGPQGALGRLRELCRRWLRPEVHTKEQMLTMLPKEIQAWLQEHRPESSEEAAALVEDLTQTLQDSDFEIQSENGENCNQDMFENESRKIFSEMPEGESAQHSDGESDFERDAGIQRLQGHTPGEDHGEVV Predict reactive species Full Name: zinc finger and SCAN domain containing 2 Calculated Molecular Weight: 70 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC136342 Gene Symbol: ZSCAN2 Gene ID (NCBI): 54993 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q7Z7L9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.